PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00039.1.g00260.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 227aa    MW: 24153.9 Da    PI: 9.2755
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00039.1.g00260.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.43.2e-3848105562
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                     +cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss
  Zjn_sc00039.1.g00260.1.sm.mk  48 GDPCPRCESRDTKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGTRKSSSSS 105
                                   578**************************************************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-254899IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.70549103IPR003851Zinc finger, Dof-type
PfamPF027012.7E-3250103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MQEPGRRRAV PFVGVDLRRP KGYPPPAAKV EEEQARVKVN AEAPATAGDP CPRCESRDTK  60
FCYYNNYNTS QPRHFCKSCR RYWTKGGSLR NVPVGGGTRK SSSSSKSSPA APRNPKRSKN  120
SRNRRVAPAP DPAHGTDDTS IAGEVNSETK PAPLTEAAGS VAPAVEDSFK SSMSVALGLG  180
VTDVGGGGKE LPDPGQFEWP SSCGDLGSFW GTGVFADTDP SLFLNLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112124RNPKRSKNSRNRR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057597e-65AP005759.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0556A05.
GenBankAP0149657e-65AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126177e-65CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankKC9967337e-65KC996733.1 Oryza sativa transcription factor Dof25 (Dof25) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957110.12e-80PREDICTED: dof zinc finger protein MNB1A-like
SwissprotP385643e-56MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLK3ZVZ32e-80K3ZVZ3_SETIT; Uncharacterized protein
STRINGSi030774m5e-80(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.12e-30Dof family protein